DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and P4H5

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:339 Identity:93/339 - (27%)
Similarity:144/339 - (42%) Gaps:80/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 SAAKDLLVDQPRKYHEVMGITKADVTLLL----ARSLIASGNVSIATDMLMRDFMFGEAGSALTV 255
            |.:|..|..||||  .|...|:|...|:|    ...|:..|.:|:                    
plant     3 SKSKQHLRYQPRK--SVSRSTQAFTVLILLLVVILILLGLGILSL-------------------- 45

  Fly   256 HFLRNKPKPSINLESWESDESFNQLCRSSSRRQMGESKPSRLHCRYNTITTPFLKLAPFRMEELS 320
                    |:.|..|.::::..|.:.:|.:.....|....|.                  :|.:|
plant    46 --------PNANRNSSKTNDLTNIVRKSETSSGDEEGNGERW------------------VEVIS 84

  Fly   321 LDPYVIFYHNVLSDAEIEKLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAWLPHQNIDPDDLE 385
            .:|..:.|||.|::.|.|.|..:.||.:.::.|...:.|..:....|::.|.:| .:..|    |
plant    85 WEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFL-RRGHD----E 144

  Fly   386 VLNRIGRRIEDMTGLNTRSGSKMQFLKYGFGGHFVPHYDYFNSKTFSLETVGDRIATVLFYLNNV 450
            |:..|.:||.|.|.:...:|..:|.|.|..|..:.||||||..: |:.:..|.||||||.||::|
plant   145 VVEVIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYFLDE-FNTKNGGQRIATVLMYLSDV 208

  Fly   451 DHGGATVFP-------------------KLNLAV-PTQKGSALFWHNIDRKSYDYDTRTFHGACP 495
            |.||.||||                   |..|:| |.::.:.|||:.  |.....|..:.||.||
plant   209 DDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNM--RPDASLDPSSLHGGCP 271

  Fly   496 LISGTKLVMTRWIY 509
            ::.|.|...|:|.:
plant   272 VVKGNKWSSTKWFH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 63/194 (32%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 72/237 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.