DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and p4htmb

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:420 Identity:98/420 - (23%)
Similarity:153/420 - (36%) Gaps:127/420 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YQIASKWLSAAKDLLVDQPRKYHEVMGITKADVT--------LLLAR------------SLIASG 231
            |...|..:||.:| ........|:|.|.:.|..|        :.|.|            ||: ||
Zfish    81 YNNGSNAISANRD-FTSSDSSSHKVTGASDAQATADSGFPRNMFLPRIEGIRVGHVQKVSLV-SG 143

  Fly   232 NVSIATDMLMRDFMF------GEAGSALTVHFLRNK---------PKPSINLE---SWESDESFN 278
            .|.....:.::..:|      .|...|:.|...:.|         |:....|:   :...:|.||
Zfish   144 KVHEMKTLSLKPLLFEIPDFLSEEECAVVVRLAQLKGLMESQVMVPEGQEELDQQLNLSPEEIFN 208

  Fly   279 QLCRSSSRRQMGESKPSRL--HCRYNT---ITTPFLKLAPFRMEELSLDPYVIFYHNVLSDAE-- 336
            .|    ...|.|:.:|..:  |.|...   :|:..||       |:        |..:.:|.:  
Zfish   209 FL----DLNQDGQLQPHEILTHSRVRDGIWLTSENLK-------EI--------YDGLKADLDGN 254

  Fly   337 -IEKLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAWL-----PHQNIDPDDLEVLNRIGRRIE 395
             :..|:..|:...:..:.|.:::|.:.....|::...||     .||        ||..:.:|:.
Zfish   255 GLLSLEEFGRLRSDAFQRFLLQRGVERSQLVRNSRHTWLYQGQGAHQ--------VLQDLRKRVT 311

  Fly   396 DMTGLNT---RSGSKMQFLKYGFGGHFVPHYD-------------YFNSKTFSLETVGDRIATVL 444
            .:|.|.:   .....:|.::|..|||:..|:|             ...:.|.|......|..|||
Zfish   312 LLTRLPSSLVELSEPLQVVRYEQGGHYHAHHDSGPVYPETACTHTRLAANTTSPFQTSCRYITVL 376

  Fly   445 FYLNNVDHGGATVFP---------------------------KLNLAVPTQKGSALFWHNI--DR 480
            ||||||..||.|.||                           |.||.|...||:|:||:|.  |.
Zfish   377 FYLNNVQEGGETTFPVADNRTYEEASLIQNDVDLLDTRKHCDKGNLRVKPVKGTAVFWYNYLSDG 441

  Fly   481 KSY--DYDTRTFHGACPLISGTKLVMTRWI 508
            :.:  :.|..:.||.|.:..|||.|...||
Zfish   442 RGWVGEQDEYSLHGGCVVTQGTKWVANNWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 58/229 (25%)
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234 16/76 (21%)
EFh 204..262 CDD:298682 16/76 (21%)
P4Hc 285..471 CDD:214780 53/193 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.