DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and CG31021

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster


Alignment Length:511 Identity:135/511 - (26%)
Similarity:218/511 - (42%) Gaps:93/511 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LLEKDRELIIVLDSYATELNEKIIMLKRIVKEFKQPLEKAKNREEEYLSNPIDSLSLMRQMHEDW 102
            :|..:|.|:..:..||.:|.|||.::...|:::...:|.|....|:|||||::|..|:|.||:||
  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANEDPEKYLSNPLNSFRLIRHMHQDW 65

  Fly   103 EKVEKLLKKPVGQEKIALVEKMREDLPVENDLMEANQAMFRILHTYDLEPKDVSAGWIDGVQYGG 167
            ...:..::..|..|.:..||.:...||.:....:|.:::..:...|..||.|:.|.  |......
  Fly    66 VGWQVYMEDLVAPEAVQKVESLLPQLPQKEAFRKAARSVHSLTQFYGYEPADLVAK--DERSSSL 128

  Fly   168 KMSASDCFTMGTFSFMAGSYQIASKWLS-AAKDLLVDQPRKYHEVMGITKADVTLLLARSLIASG 231
            .:|..||:.:|...:....|..|:|||. ||.:..:.:.|.....:|..:..|...|.|:|:   
  Fly   129 HLSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFNPLGAPRWQVYRDLGRTLL--- 190

  Fly   232 NVSIATDMLMRDFMFGEAGSAL-----TVHFLRN-------------------KPKPSINLESWE 272
                   .|.|...:....|||     .||.::.                   :|||:: ||.: 
  Fly   191 -------KLNRQCAYDAYESALRLNSQNVHLMKEAGQMELFSLRDPMEPILDLQPKPTV-LEKY- 246

  Fly   273 SDESFNQLCRSSSRRQMGESKPSRLHCRYNTITTPFLKLAPFRMEELSLDPYVIFYHNVLSDAEI 337
                    ||....|..|     ||.|..|.....||..||.:.|:|..||::|.|...:.:.||
  Fly   247 --------CRGEVPRHQG-----RLTCELNDWVHSFLAYAPIKFEDLQQDPFIILYPGSIYEQEI 298

  Fly   338 -------EKLKPMGKPFLERAKVFRVEKGSDEIDPSRSADGAWLPHQNIDPDDLEVLNRIGRRIE 395
                   |:..|..:        |.::.|   |.....:|| :.|          ||.||..||.
  Fly   299 RHVENAYERCPPNDR--------FELKLG---ISGCSISDG-YSP----------VLKRINERIL 341

  Fly   396 DMTGLNTRSGSKMQFLKYGFGGHFVPHYDYFNSKTF---SLETVGDRIATVLFYLNNVDHGGATV 457
            ||.|:. ::......::|.....|.|...:.||..|   :|....|..|.|:.:|.:|..|||..
  Fly   342 DMAGVE-KTWDTFYIVEYAQLAPFEPFKLFRNSTKFPKLNLMNFEDVEAKVIIFLKDVTLGGAFT 405

  Fly   458 FPKLNLAVPTQKGSALFWHNIDRKSYDYDTRTFHGACPLISGTKLVMTRWIYELDQ 513
            .|..::.|..::|:.|    |..::.::.|.    .||:|.||.|||.::|.:.|:
  Fly   406 MPNGDILVQPKRGNVL----ITFENEEHSTT----ICPIIEGTGLVMIKFIMKTDE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528 37/121 (31%)
P4Hc 333..508 CDD:214780 48/184 (26%)
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452374
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391515at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.