DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and P4htm

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:339 Identity:78/339 - (23%)
Similarity:118/339 - (34%) Gaps:141/339 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 LSLDPYVIFYHNVLSDAEIEKLKPMGK-PFLERAKVFRVEKGSD--------EID---------- 364
            |||.|.:......|||.|...:..:.: ..|:|:::...|:..:        ::|          
  Rat   139 LSLKPLLFEIPGFLSDEECRLIIHLAQMKGLQRSQILPTEEYEEAMSAMRVSQLDLFQLLDQNHD 203

  Fly   365 ----------PSRSADGAWLPHQNI---------DPD-------------DL------------- 384
                      .:|..:|.|:..:||         |||             ||             
  Rat   204 GRLQLREVLAQTRLGNGRWMTPENIQEMYSAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAE 268

  Fly   385 --------------------EVLNRIGRRIEDMTGLN---TRSGSKMQFLKYGFGGHFVPHYD-- 424
                                .|:..|.:|:..:|.|:   ......:|.::||.|||:..|.|  
  Rat   269 SSELVRNSHHTWLHQGEGAHHVMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSG 333

  Fly   425 -------YFNSKTFSLETV----GDRIATVLFYLNNVDHGGATVFP------------------- 459
                   ..::|..:.|:|    ..|..|||||||||..||.||||                   
  Rat   334 PVYPETVCSHTKLVANESVPFETSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDNVDL 398

  Fly   460 --------KLNLAVPTQKGSALFWHNI--DRKSY--DYDTRTFHGACPLISGTKLVMTRWIYELD 512
                    |.||.|..|:|:|:||:|.  |.:.:  :.|..:.||.|.:..|||.:...||    
  Rat   399 RDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVGEVDDYSLHGGCLVTRGTKWIANNWI---- 459

  Fly   513 QMFLIPAVLPPRSR 526
                  .|.|.|:|
  Rat   460 ------NVDPSRAR 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 67/305 (22%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 9/59 (15%)
P4Hc 247..459 CDD:214780 52/211 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.