DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31016 and LOC110438249

DIOPT Version :9

Sequence 1:NP_001263119.1 Gene:CG31016 / 326113 FlyBaseID:FBgn0051016 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:230 Identity:89/230 - (38%)
Similarity:128/230 - (55%) Gaps:14/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 MGESKPSRLHCRYNTITTPFLKLAPFRMEELSLD-PYVIFYHNVLSDAEIEKLKPMGKPFLERAK 352
            |...:..:|.|||.......|.|  |: ||:..| |.::.||:.||:.||:.:|.:.:|.|.||:
Zfish     1 MTPQRERKLVCRYRRGRGNPLML--FK-EEVEWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQ 62

  Fly   353 VFRVEKGSDEIDPSRSADGAWLPHQNIDPDDLEVLNRIGRRIEDMTGLNTRSGSKMQFLKYGFGG 417
            |.....|......||.:..||| :::.||    |:.::.:||.|:|||..::...:|...||.||
Zfish    63 VIDAVSGKRVSAASRVSQSAWL-YEDEDP----VVTQVNQRIADVTGLELQTAESLQIANYGIGG 122

  Fly   418 HFVPHYD--YFNSKTFSLETVGDRIATVLFYLNNVDHGGATVFPKLNLAVPTQKGSALFWHNIDR 480
            .:.||||  ..|...|.|.  |.||||||.|:::||.|||||||.:..|:..::|||:.|.|:.|
Zfish   123 QYEPHYDSKLTNDSDFQLR--GGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLLR 185

  Fly   481 KSYDYDTRTFHGACPLISGTKLVMTRWIYELDQMF 515
            ...: |.||.|.|||:..|:|.|..:||....|.|
Zfish   186 NGNE-DIRTLHAACPVFVGSKWVANKWIRTYGQEF 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31016NP_001263119.1 P4Ha_N 31..160 CDD:285528
P4Hc 333..508 CDD:214780 70/176 (40%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 77/197 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.