DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and AT5G66060

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_201407.4 Gene:AT5G66060 / 836738 AraportID:AT5G66060 Length:289 Species:Arabidopsis thaliana


Alignment Length:247 Identity:69/247 - (27%)
Similarity:115/247 - (46%) Gaps:42/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 TQVCRGELHQSPREQRNLRCWLYHQGVPYYRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTIMEHG 357
            |.:.|..|.:|..:......|               :|.::.:|..:..|..|...|...::|..
plant    57 TSIVRKTLQRSGEDDSKNERW---------------VEIISWEPRASVYHNFLTKEECKYLIELA 106

  Fly   358 KGNMERSKV--GQSENSTTSEVRISRNTWLWYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYG 420
            |.:||:|.|  .::..||.|.||.|..|:|....:..:.:|::|:.|.|.:..|..|.||:::|.
plant   107 KPHMEKSTVVDEKTGKSTDSRVRTSSGTFLARGRDKTIREIEKRISDFTFIPVEHGEGLQVLHYE 171

  Fly   421 IGGQYEPHFDFVEDDGQSVFSWK--GNRLLTALFYLNDVALGGATAFPFLR-------------- 469
            ||.:||||:|:..|:    ::.:  |.|:.|.|.||:||..||.|.||..:              
plant   172 IGQKYEPHYDYFMDE----YNTRNGGQRIATVLMYLSDVEEGGETVFPAAKGNYSAVPWWNELSE 232

  Fly   470 -----LAVPPVKGSLLIWYNLHSSTHKDFRTKHAGCPVLQGSKWICNEWFHV 516
                 |:|.|..|..|:::::......|..:.|.||.|::|:||...:|..|
plant   233 CGKGGLSVKPKMGDALLFWSMTPDATLDPSSLHGGCAVIKGNKWSSTKWLRV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 59/190 (31%)
AT5G66060NP_201407.4 PLN00052 74..288 CDD:177683 65/230 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.