DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and AT5G18900

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:234 Identity:75/234 - (32%)
Similarity:119/234 - (50%) Gaps:32/234 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LSPFKIEQLNVDPYVAYVHE-VLWDSEIDTIMEHGKGNMERSKVGQSEN--STTSEVRISRNTWL 385
            ::|.|::|::..|. |:|:| .|.:.|.|.::...|.:::||.|..:::  |..||||.|..|::
plant    32 VNPSKVKQVSSKPR-AFVYEGFLTELECDHMVSLAKASLKRSAVADNDSGESKFSEVRTSSGTFI 95

  Fly   386 WYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDDGQSVFSWKGNRLLTA 450
            ....:|.:|.|:.::...|.|..|:.|.:|::.|..|.:|:.|||:..|....|..  |:|:.|.
plant    96 SKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDAHFDYFHDKVNIVRG--GHRMATI 158

  Fly   451 LFYLNDVALGGATAFPFLR---------------------LAVPPVKGSLLIWYNLHSSTHKDFR 494
            |.||::|..||.|.||...                     :||.|.||..|:::|||.....|..
plant   159 LMYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSDCAKRGIAVKPRKGDALLFFNLHPDAIPDPL 223

  Fly   495 TKHAGCPVLQGSKWICNEWFHVGAQEFRR---PCGLSSD 530
            :.|.||||::|.||...:|.||  ..|.|   |.|..:|
plant   224 SLHGGCPVIEGEKWSATKWIHV--DSFDRIVTPSGNCTD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 60/190 (32%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 75/233 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.