DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and AT4G35820

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:199 Identity:56/199 - (28%)
Similarity:95/199 - (47%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 RCWLYHQGVPYYRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTIMEHGKGNMERSKV-----GQSE 370
            |.::||..:..:    |||.:.|              .|.|.::...|.:|.||||     |..|
plant    96 RAFVYHNFLALF----FKICKTN--------------EECDHLISLAKPSMARSKVRNALTGLGE 142

  Fly   371 NSTTSEVRISRNTWLWYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDD 435
            .|::   |.|..|::....:..:.:|::|:.:.|.:..|:.|.||::||.:|.::|||||..:  
plant   143 ESSS---RTSSGTFIRSGHDKIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGFQ-- 202

  Fly   436 GQSVFSWKGNRLLTALFYLNDVALGGATAFPFLR-------LAVPPVKGSLLIWYNLHSSTHKDF 493
                      |:.|.|.||:||..||.|.||..:       ::|.|.||..|:::::.....:|.
plant   203 ----------RIATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKKGDALLFWSMRPDGSRDP 257

  Fly   494 RTKH 497
            .:||
plant   258 SSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 49/163 (30%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927
P4Hc 115..262 CDD:214780 49/162 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 1 0.900 - - OOG6_109884
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.