DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and AT4G35810

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001320148.1 Gene:AT4G35810 / 829735 AraportID:AT4G35810 Length:290 Species:Arabidopsis thaliana


Alignment Length:211 Identity:65/211 - (30%)
Similarity:108/211 - (51%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 IEQLNVDPYVAYVHEVLWDSEIDTIMEHGKGNMERSKV--GQSENSTTSEVRISRNTWLWYDANP 391
            :|.::.:|.....|..|.:.|.:.::...|.:|.:|||  .::..|..|.||.|..|:|....:.
plant    80 LEVISWEPRAFVYHNFLTNEECEHLISLAKPSMMKSKVVDVKTGKSIDSRVRTSSGTFLNRGHDE 144

  Fly   392 WLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDDGQSVFSWK--GNRLLTALFYL 454
            .:.:|:.|:.|.|.:..|:.|.||:::|.:|.:||||.|:..|:    |:.:  |.|:.|.|.||
plant   145 IVEEIENRISDFTFIPPENGEGLQVLHYEVGQRYEPHHDYFFDE----FNVRKGGQRIATVLMYL 205

  Fly   455 NDVALGGATAFPFLR-------------------LAVPPVKGSLLIWYNLHSSTHKDFRTKHAGC 500
            :||..||.|.||..:                   |:|.|.|...|:::::......|..:.|.||
plant   206 SDVDEGGETVFPAAKGNVSDVPWWDELSQCGKEGLSVLPKKRDALLFWSMKPDASLDPSSLHGGC 270

  Fly   501 PVLQGSKWICNEWFHV 516
            ||::|:||...:||||
plant   271 PVIKGNKWSSTKWFHV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 58/190 (31%)
AT4G35810NP_001320148.1 PLN00052 75..289 CDD:177683 65/211 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.