DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and AT3G28490

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:219 Identity:70/219 - (31%)
Similarity:108/219 - (49%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 YRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTIMEHGKGNMERSKV------GQSENSTTSEVRIS 380
            :.:.|.:|.||:..|........|.|.|.|.:::..||.:|:|.|      |:||:   ||||.|
plant    25 FSVDPTRITQLSWTPRAFLYKGFLSDEECDHLIKLAKGKLEKSMVVADVDSGESED---SEVRTS 86

  Fly   381 RNTWLWYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDDGQSVFSWKGN 445
            ...:|....:..::.::.:|...|.|..|:.|.||:::|..|.:|:||||:..|  :......|:
plant    87 SGMFLTKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYFYD--KKALELGGH 149

  Fly   446 RLLTALFYLNDVALGGATAFPFLR------------------LAVPPVKGSLLIWYNLHSSTHKD 492
            |:.|.|.||::|..||.|.||..:                  .||.|.||..|:::|||.:...|
plant   150 RIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLHLNGTTD 214

  Fly   493 FRTKHAGCPVLQGSKWICNEWFHV 516
            ..:.|..|||::|.||....|.||
plant   215 PNSLHGSCPVIEGEKWSATRWIHV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 62/191 (32%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 70/216 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.