DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and AT3G28480

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:235 Identity:74/235 - (31%)
Similarity:113/235 - (48%) Gaps:32/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 YRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTIMEHGKGNMERSKV-----GQSENS--TTSEVRI 379
            :...|.::.||:..|.|......|.|.|.|..::..||.:|:|.|     |:|..|  :.|.||.
plant    49 FGFDPTRVTQLSWTPRVFLYEGFLSDEECDHFIKLAKGKLEKSMVADNDSGESVESEDSVSVVRQ 113

  Fly   380 SRNTWLWYDA---NPWLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDDGQSVFS 441
            |.:.....|:   :..:|.::.:|...|.|..|:.|.:|:::|..|.:||||||:..|  |:...
plant   114 SSSFIANMDSLEIDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQKYEPHFDYFHD--QANLE 176

  Fly   442 WKGNRLLTALFYLNDVALGGATAFPFLR------------------LAVPPVKGSLLIWYNLHSS 488
            ..|:|:.|.|.||::|..||.|.||..:                  .||.|.||..|:::|||.:
plant   177 LGGHRIATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVKPRKGDALLFFNLHPN 241

  Fly   489 THKDFRTKHAGCPVLQGSKWICNEWFHVGAQE--FRRPCG 526
            ...|..:.|..|||::|.||....|.||.:.|  |.:..|
plant   242 ATTDSNSLHGSCPVVEGEKWSATRWIHVKSFERAFNKQSG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 63/195 (32%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 74/233 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.