DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and P4H2

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:217 Identity:74/217 - (34%)
Similarity:116/217 - (53%) Gaps:27/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LSPFKIEQLNVDPYVAYVHE-VLWDSEIDTIMEHGKGNMERSKVGQSEN--STTSEVRISRNTWL 385
            ::|.|::|::..|. |:|:| .|.|.|.|.::...|.|::||.|..::|  |..|:||.|..|::
plant    33 INPSKVKQVSSKPR-AFVYEGFLTDLECDHLISLAKENLQRSAVADNDNGESQVSDVRTSSGTFI 96

  Fly   386 WYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDDGQSVFSWKGNRLLTA 450
            ....:|.:|.|:.:|...|.|..|:.|.||::.|..|.:|:.|||:..|  :...:..|:|:.|.
plant    97 SKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHD--KVNIARGGHRIATV 159

  Fly   451 LFYLNDVALGGATAFP----FLR-----------------LAVPPVKGSLLIWYNLHSSTHKDFR 494
            |.||::|..||.|.||    |.|                 :||.|.||:.|:::||......|..
plant   160 LLYLSNVTKGGETVFPDAQEFSRRSLSENKDDLSDCAKKGIAVKPKKGNALLFFNLQQDAIPDPF 224

  Fly   495 TKHAGCPVLQGSKWICNEWFHV 516
            :.|.||||::|.||...:|.||
plant   225 SLHGGCPVIEGEKWSATKWIHV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 64/190 (34%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 64/191 (34%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.