DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:247 Identity:63/247 - (25%)
Similarity:110/247 - (44%) Gaps:23/247 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 KESYKLYTQVCRGELHQSPREQRNLRCWLYHQGVPYYRLSPFKIEQLNVDPYVAYVHEVLWDSEI 350
            ::||.......||...|:.|..|::..|...:.....|:...|.|.::..|.:..:|:.|...|.
plant    34 EDSYGTGFPSLRGLRGQNTRYLRDVSRWANDKDAELLRIGNVKPEVVSWSPRIIVLHDFLSPEEC 98

  Fly   351 DTIMEHGKGNMERSKV--GQSENSTTSEVRISRNTWLWY--DANPWLSKIKQRLEDVTGLSTESA 411
            :.:....:..::.|.|  .::.....|:||.|...:|.:  .:.|.:..|::|:...:.:..|:.
plant    99 EYLKAIARPRLQVSTVVDVKTGKGVKSDVRTSSGMFLTHVERSYPIIQAIEKRIAVFSQVPAENG 163

  Fly   412 EPLQLVNYGIGGQYEPHFDFVEDDGQSVFSWK--GNRLLTALFYLNDVALGGATAFPFL------ 468
            |.:|::.|.....|:||.|:..|    .|:.|  |.|:.|.|.||.|...||.|.||..      
plant   164 ELIQVLRYEPQQFYKPHHDYFAD----TFNLKRGGQRVATMLMYLTDDVEGGETYFPLAGDGDCT 224

  Fly   469 -------RLAVPPVKGSLLIWYNLHSSTHKDFRTKHAGCPVLQGSKWICNEW 513
                   .::|.|.||..::::::......|.|:.|.||.||.|.||...:|
plant   225 CGGKIMKGISVKPTKGDAVLFWSMGLDGQSDPRSIHGGCEVLSGEKWSATKW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 49/186 (26%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 52/201 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.