DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and p4htmb

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:397 Identity:96/397 - (24%)
Similarity:144/397 - (36%) Gaps:123/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 GKPLGFISPNVSDVEI--LEHLSSAFNGLGNLK-LAYK-LNNEILDKKPDHEEALKNKILYEGQL 263
            |.|.....|.:..:.:  ::.:|.....:..:| |:.| |..||.|...:.|.|:..::.....|
Zfish   117 GFPRNMFLPRIEGIRVGHVQKVSLVSGKVHEMKTLSLKPLLFEIPDFLSEEECAVVVRLAQLKGL 181

  Fly   264 ARERSFAPRKQVELPQIAEKEQKESYKLYTQVCRGELHQSPREQRNLRCWLYHQGVPYYRLSPFK 328
            ...:...|..|.||.|                   :|:.||.|                   .|.
Zfish   182 MESQVMVPEGQEELDQ-------------------QLNLSPEE-------------------IFN 208

  Fly   329 IEQLNVDPYVAYVHEVLWDSEI--------DTIME---------HGKGNMERSKVGQSENST--- 373
            ...||.|..: ..||:|..|.:        :.:.|         .|.|.:...:.|:..:..   
Zfish   209 FLDLNQDGQL-QPHEILTHSRVRDGIWLTSENLKEIYDGLKADLDGNGLLSLEEFGRLRSDAFQR 272

  Fly   374 ---------TSEVRISRNTWLW--YDANPWLSKIKQRLEDVTGLST---ESAEPLQLVNYGIGGQ 424
                     :..||.||:|||:  ..|:..|..:::|:..:|.|.:   |.:||||:|.|..||.
Zfish   273 FLLQRGVERSQLVRNSRHTWLYQGQGAHQVLQDLRKRVTLLTRLPSSLVELSEPLQVVRYEQGGH 337

  Fly   425 YEPHFDF-------------VEDDGQSVFSWKGNRLLTALFYLNDVALGGATAFPFL-------- 468
            |..|.|.             :..:..|.|. ...|.:|.|||||:|..||.|.||..        
Zfish   338 YHAHHDSGPVYPETACTHTRLAANTTSPFQ-TSCRYITVLFYLNNVQEGGETTFPVADNRTYEEA 401

  Fly   469 -------------------RLAVPPVKGSLLIWYNLHSS-----THKDFRTKHAGCPVLQGSKWI 509
                               .|.|.||||:.:.|||..|.     ..:|..:.|.||.|.||:||:
Zfish   402 SLIQNDVDLLDTRKHCDKGNLRVKPVKGTAVFWYNYLSDGRGWVGEQDEYSLHGGCVVTQGTKWV 466

  Fly   510 CNEWFHV 516
            .|.|.:|
Zfish   467 ANNWINV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 65/246 (26%)
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234 12/77 (16%)
EFh 204..262 CDD:298682 12/77 (16%)
P4Hc 285..471 CDD:214780 59/186 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.