DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and p4htma

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001074160.1 Gene:p4htma / 791209 ZFINID:ZDB-GENE-070112-2222 Length:478 Species:Danio rerio


Alignment Length:372 Identity:86/372 - (23%)
Similarity:126/372 - (33%) Gaps:111/372 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 KPLGFISPNVSDVEILEHLSSAFNGLGNLKLAYKLNNEILDKKPDHEEALKNKILY-------EG 261
            |||.|..|....||    .|:....|..||   .|.:..|...||.||.|....|:       :|
Zfish   139 KPLLFEIPGFLSVE----ESNVVMQLAQLK---GLTHSSLLTNPDQEEQLTQDELFSLLDLNQDG 196

  Fly   262 QLARERSFAPRKQVELPQIAEKEQKESYKLYTQVCRGELHQSPREQRNLRCWLYHQGVPYYRLSP 326
            .|.||      :.:.|....:.....||                   |||  ..|.|        
Zfish   197 LLQRE------EILSLSHSTDGSWLSSY-------------------NLR--KIHTG-------- 226

  Fly   327 FKIEQLNVDPYVAYVHEVLWDSEIDTIMEHGK---GNMERSKVGQSENSTTSEVRISRNT--WLW 386
                 |..:|           |.:.::.|..:   |.:..|...|..:..|...:.|.:|  :|.
Zfish   227 -----LETNP-----------SGVLSLQEFKRVSGGVLRYSGAAQGLDGHTKVRQRSTHTRLYLG 275

  Fly   387 YDANPWLSKIKQRLEDVTGLST---ESAEPLQLVNYGIGGQYEPHFDFV---EDDGQSVFSWKGN 445
            ...:..|..::.|:..:|.|.:   :.:|.:::|.|..|.....|.|..   .|:..:......|
Zfish   276 EGTHHLLKSVRNRVTRLTRLPSSLVDLSEAMEVVRYEQGVFSHAHHDSSPTHPDNSCTHTHLAAN 340

  Fly   446 -------RLLTALFYLNDVALGGATAFPFL---------------------RLAVPPVKGSLLIW 482
                   |.||.|.|||....||.|:||..                     .|.|.||.|:.|:|
Zfish   341 TSNQVACRYLTVLLYLNSADSGGETSFPVADNRTYEEEVLGDLSQQYCDKGNLKVKPVAGTALLW 405

  Fly   483 YNLHSST------HKDFRTKHAGCPVLQGSKWICNEWFHVGAQEFRR 523
            || |.|.      ..|..:.|..|.|.:|.||..:.|.::...:.|:
Zfish   406 YN-HLSDGNGWVGELDEFSLHGDCLVTRGFKWTGSVWVNIDPDQQRQ 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 52/212 (25%)
p4htmaNP_001074160.1 2OG-FeII_Oxy <272..442 CDD:304390 43/170 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.