DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:233 Identity:59/233 - (25%)
Similarity:102/233 - (43%) Gaps:15/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 EQRNLRCWLYHQGVPYYRLSPFKIEQLNVDPYVAYVHEVLWDSEID---TIMEHGKGNMERSKVG 367
            |.::..|:.|.|     .....|:|.:...|.:....::....::.   .:|||.|.. |:..|.
 Worm     6 EWKHAVCFEYLQ-----NFQIVKVEVVAWRPGLVIYRDLFTGKQVRDHLELMEHLKFE-EQLVVN 64

  Fly   368 QSENSTTSEVRISRNTWLWYDANPWLSKIKQRLED-VTGLSTESAEPLQLVNYGIGGQYEPHFDF 431
            ...|...|::|.:..|.::::.:|....|....:: :..|:.::||.:..::|..||.|..|.|:
 Worm    65 DDGNDIVSKIRRANGTQVFHEDHPAARSIWDTAKNLLPNLNFKTAEDILALSYNPGGHYAAHHDY 129

  Fly   432 V----EDDGQSVFSWKGNRLLTALFYLNDVALGGATAFPFLRLAVPPVKGSLLIWYNLHSSTHKD 492
            :    |.:........|||..|.:........||||.||.|..||....|....|:|...::.::
 Worm   130 LLYPSEKEWDEWMRVNGNRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNSEQE 194

  Fly   493 FRTKHAGCPVLQGSKWICNEWFHVGAQEFRRPCGLSSD 530
            ..::|||||:.:|.|.|...|..:..|...... ||||
 Worm   195 DLSEHAGCPIYKGQKQISTIWLRMRDQPILEQT-LSSD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 47/175 (27%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 47/174 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.