DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and P4HA1

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_000908.2 Gene:P4HA1 / 5033 HGNCID:8546 Length:534 Species:Homo sapiens


Alignment Length:541 Identity:190/541 - (35%)
Similarity:298/541 - (55%) Gaps:56/541 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YYSAISELERLLDVEAFIVEKFDEYLERAQQEQENLKRFLDQIDE-QQNDRGDLEEYFGNPINAF 83
            ::::|.::..|:..|..:|....:|::..:.:.|.:|::.:::|. ......|.|.:.|:|:|||
Human    21 FFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAF 85

  Fly    84 ITIKRLVHDWKFNVFDPVFDSSNFET-YKNNLSD------SLEKINFKGPTQEDLHGATRALLRL 141
            ..:|||..:|           |..|. ...::||      ::::..|  |..||..||.:|||||
Human    86 KLMKRLNTEW-----------SELENLVLKDMSDGFISNLTIQRQYF--PNDEDQVGAAKALLRL 137

  Fly   142 QNMYQLNTDHLASGVLHPGEKNALGTSLSASDCFELGKNLCEIKEYSYGSEWLLEARKRLHGKPL 206
            |:.|.|:||.::.|.| ||.|:.  :.|:|.|||||||......:|.:...|:.:|.::|..   
Human   138 QDTYNLDTDTISKGNL-PGVKHK--SFLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDE--- 196

  Fly   207 GFISPNVSDVEILEHLSSAFNGLGNLKLAYKLNNEILDKKPDHEEALKNKILYEGQLARERSF-- 269
            |.|| .:..|.:|::||.|....|:|..|..|..::|:..|:|:.|..|...:|..:|:|:..  
Human   197 GEIS-TIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNK 260

  Fly   270 -----------APRKQ-VELPQIAEKEQKESYKLYTQVCRGE-LHQSPREQRNLRCWLYHQG--V 319
                       .|:|: |.:..:.|:::      |..:|||| :..:||.|:.|.| .||.|  .
Human   261 SASDDQSDQKTTPKKKGVAVDYLPERQK------YEMLCRGEGIKMTPRRQKKLFC-RYHDGNRN 318

  Fly   320 PYYRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTIMEHGKGNMERSKVGQSENS--TTSEVRISRN 382
            |.:.|:|.|.|.....|.:...|:::.|:||:.:.:..|..:.|:.|...|..  ||::.|:|::
Human   319 PKFILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTTAQYRVSKS 383

  Fly   383 TWLWYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDDGQSVFS--WKGN 445
            .||....||.:|:|..|::|:|||...:||.||:.|||:||||||||||...|....|.  ..||
Human   384 AWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFKELGTGN 448

  Fly   446 RLLTALFYLNDVALGGATAFPFLRLAVPPVKGSLLIWYNLHSSTHKDFRTKHAGCPVLQGSKWIC 510
            |:.|.|||::||:.||||.||.:..:|.|.||:.:.||||.:|...|:.|:||.||||.|:||:.
Human   449 RIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVS 513

  Fly   511 NEWFHVGAQEFRRPCGLSSDE 531
            |:|.|...|||||||.||..|
Human   514 NKWLHERGQEFRRPCTLSELE 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528 40/141 (28%)
P4Hc 347..515 CDD:214780 78/171 (46%)
P4HA1NP_000908.2 P4Ha_N 25..112 CDD:400573 23/97 (24%)
TPR 205..238 11/32 (34%)
P4Hc 345..518 CDD:214780 78/172 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.