DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and CG31021

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_733392.2 Gene:CG31021 / 43638 FlyBaseID:FBgn0051021 Length:453 Species:Drosophila melanogaster


Alignment Length:540 Identity:125/540 - (23%)
Similarity:212/540 - (39%) Gaps:163/540 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLDVEAFIVEKFDEYLERAQQEQENLKRFLDQID---EQQNDRGDLEEYFGNPINAFITIKRLVH 91
            :|::|..:::...:|.|:.:::.:.:..:::..:   |..|:  |.|:|..||:|:|..|:.:..
  Fly     1 MLNLERNLLQNMRDYAEKLEEKIDLINNYVEDYNVDIEDANE--DPEKYLSNPLNSFRLIRHMHQ 63

  Fly    92 DWKFNVFDPVFDSSNFETYKNNL--SDSLEKINF---KGPTQEDLHGATRALLRLQNMYQLNTDH 151
            ||           ..::.|..:|  .::::|:..   :.|.:|....|.|::..|...|......
  Fly    64 DW-----------VGWQVYMEDLVAPEAVQKVESLLPQLPQKEAFRKAARSVHSLTQFYGYEPAD 117

  Fly   152 LA-----SGVLHPGEKNALGTSLSASDCFELGKNLCEIKEYSYGSEWLLEA-------RKRLHGK 204
            |.     |..||          ||..||:.||..|.|.::|...::||..|       |.|....
  Fly   118 LVAKDERSSSLH----------LSPLDCYHLGLELYEEQDYLGAAKWLQVAAHNYTLSRHRDLFN 172

  Fly   205 PLGFISPNVSDVEILEHLSSAFNGLGNLKLAYKLNNEILDKKPDHEEALK----NKILYE--GQL 263
            |||  :|.          ...:..||...|  |||.:.  ....:|.||:    |..|.:  ||:
  Fly   173 PLG--APR----------WQVYRDLGRTLL--KLNRQC--AYDAYESALRLNSQNVHLMKEAGQM 221

  Fly   264 ARERSFAPRKQVE-------LPQIAEKEQKESYKLYTQVCRGELHQSPREQRNLRC----WLYHQ 317
               ..|:.|..:|       .|.:.||           .||||:   ||.|..|.|    |: |.
  Fly   222 ---ELFSLRDPMEPILDLQPKPTVLEK-----------YCRGEV---PRHQGRLTCELNDWV-HS 268

  Fly   318 GVPYYRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTIMEHGKGNMERS--------KVGQSENSTT 374
            .:.|   :|.|.|.|..||::......:::.||    .|.:...||.        |:|.|..|.:
  Fly   269 FLAY---APIKFEDLQQDPFIILYPGSIYEQEI----RHVENAYERCPPNDRFELKLGISGCSIS 326

  Fly   375 SEVRISRNTWLWYDANPWLSKIKQRLEDVTGLSTESAEPLQLVNYGIGGQYEP------------ 427
            .            ..:|.|.:|.:|:.|:.|:. ::.:...:|.|.....:||            
  Fly   327 D------------GYSPVLKRINERILDMAGVE-KTWDTFYIVEYAQLAPFEPFKLFRNSTKFPK 378

  Fly   428 ----HFDFVEDDGQSVFSWKGNRLLTALFYLNDVALGGATAFPFLRLAVPPVKGSLLIWY--NLH 486
                :|:.||              ...:.:|.||.||||...|...:.|.|.:|::||.:  ..|
  Fly   379 LNLMNFEDVE--------------AKVIIFLKDVTLGGAFTMPNGDILVQPKRGNVLITFENEEH 429

  Fly   487 SSTHKDFRTKHAGCPVLQGS 506
            |:|.         ||:::|:
  Fly   430 STTI---------CPIIEGT 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528 27/139 (19%)
P4Hc 347..515 CDD:214780 41/186 (22%)
CG31021NP_733392.2 P4Ha_N 1..119 CDD:285528 25/130 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391515at2759
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.