DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and CG4174

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster


Alignment Length:556 Identity:132/556 - (23%)
Similarity:225/556 - (40%) Gaps:140/556 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IILSLLCVFPVNGDYYSAISELE---------RLLDVEAFIVEKFDEYLERAQQEQENLKRFLDQ 61
            ::::....|.|.|:..||....:         .||.::...|.....|.:..::..:.::|.:.|
  Fly     6 VVVTACLGFQVKGEVVSAPESYDFAISSESQLSLLKLKETHVNNLQSYKKVLKKHLQKIRRAIRQ 70

  Fly    62 IDE-----QQNDRGDLEEYFGNPINAFITIKRLVHDWKFNVFDPVFDSSNFETYKNNLSDSLEKI 121
            .:|     :.:.|        |.|..:..::.|.:||      |.:    |...|.:|  .||:|
  Fly    71 SEELLKSTKTSPR--------NLIYGYKVLRHLHNDW------PQY----FRLLKKDL--GLEQI 115

  Fly   122 NF------KGPTQEDLHGATRALLRLQNMYQLNTDHLASGVLHPGEKNALGTSLSASDCFELGKN 180
            ..      :.||..|...:..|:.|||.:|.|::..:..|.:...:||.  .:.||.:|..||..
  Fly   116 AVSQMLLTQQPTSVDFEESMGAMHRLQTVYNLDSYAMTEGFIDDKDKNI--RNWSADECLMLGLM 178

  Fly   181 LCEIKEYSYGSEWLLEARKRLHGKPLGFISPNVSDVE------ILEHLSSAFNGLGNLKLAYKLN 239
            ...:|:|:....||..|.......    :||.|..::      :||.|..|..|||:...|.|..
  Fly   179 YLFLKDYNQSENWLELALYHYDDN----VSPEVLKIKLWNYPNLLESLVEANKGLGHYFEAKKYA 239

  Fly   240 NEILDKKPDHEEALKNKILYEGQLARERSFAPRKQVELPQIAEKEQ--------KESYKLYTQVC 296
            ||:|...|:|...|                     .:||::...:.        |:.::|..::|
  Fly   240 NELLSINPNHTYML---------------------TQLPKLKHLQSNPAKLTKPKKVFQLQKEIC 283

  Fly   297 RGELHQSPREQRN---LRCWLYHQGVPYYRLSPFKIEQLNVDPYVAYVHEVLWDSEIDTI----- 353
                  |.|.:|.   |.| .|....|:.:|:|.|:|:|::.||::..:..|...:|:.:     
  Fly   284 ------SKRYRRKSGVLVC-RYVDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSR 341

  Fly   354 -----MEHGKGNMERSKVGQSENSTTSEVRISRNTWLWYDANPWLSKIKQRLEDVTGLSTESAEP 413
                 :||..||.. .|:|....|....||                |:.:.:..:||...:..:.
  Fly   342 PKLQRIEHLSGNCS-CKIGNLSTSLHDVVR----------------KVNELILGITGFPLKGNQM 389

  Fly   414 LQLVNYGIGGQYEPHFDFVEDDGQSVFSWKGNRLLTALFYLNDVALGGATAFPFLRLAVPPVKGS 478
            |:::||||.|.|.|....:.:        |.|    |..:|::...||...||...|.|.|.|||
  Fly   390 LEVINYGIAGNYNPEEPKIHN--------KAN----AFIFLSNAGKGGEIVFPSRHLKVRPRKGS 442

  Fly   479 LLIWYNLHSST--HKDFRTKHAGCPVLQGSKWICNE 512
            :|:|.||..|.  |:        ||:|:|:.|:.|:
  Fly   443 MLVWENLKKSLIYHQ--------CPILKGNMWVANK 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528 31/153 (20%)
P4Hc 347..515 CDD:214780 47/178 (26%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 30/143 (21%)
TPR repeat 169..197 CDD:276809 9/27 (33%)
TPR repeat 202..245 CDD:276809 15/46 (33%)
2OG-FeII_Oxy <362..470 CDD:304390 39/143 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.