DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and CG34041

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:389 Identity:80/389 - (20%)
Similarity:141/389 - (36%) Gaps:102/389 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IILSLLCVFPV----------NGDYYSAISELE--RLLDVEAFIVEKFDEYLERAQQEQENLKRF 58
            |::...|:..|          |.:...::|:.:  .:|.::..:|:..:.|:..       |:..
  Fly   231 IVMKSACILSVGLIIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYA-------LETK 288

  Fly    59 LDQIDEQQNDRGDLEEYF--------GNPINAFITIKRLVHDW-KFNVF---DPVFDSSNFETYK 111
            |..|||...|.......|        .:|:.::..|..:..|| .:.:|   ||         .|
  Fly   289 LKTIDEALIDLATYHIQFERDKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDP---------GK 344

  Fly   112 NNLSDSLEKINFKGPTQEDLHGATRALLRLQNMYQLNTDHLASGVLHPGEKNALGTS-------- 168
            :.|: ||..|....||:.|:......:.::.|.|.:....:|:||:       |||.        
  Fly   345 DELA-SLMSIKKYLPTKNDISEVCHGISKMLNAYLMTAQDIANGVI-------LGTQTKYISSAL 401

  Fly   169 ---------------LSASDCFELGKNLCEIKEYSYGSEWLLEARKRLHGKPLGFISPNVSDVEI 218
                           :|..||..|..:..|:|:|:...|||..|...|...  .:..|.|...::
  Fly   402 KLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYNKSKEWLNVAISMLESS--AYWDPIVPSADL 464

  Fly   219 LEHLSSAFNGLGNLKLAYKLNNEILDKKPDHEEALK--NKILYEGQLARERSFAPRKQVELPQIA 281
            ...|:..:....|..||.:.....|...|.:.:.::  .::.|...|...:|  |:..:|     
  Fly   465 YLKLAEVYVKQQNWTLALETVEFALKSNPRNAQLIRMQKRLSYHILLGPPKS--PKLNIE----- 522

  Fly   282 EKEQKESYKLYTQVCRGELHQSPREQRNLRCWLYHQGVP--YYRLSPFKIEQLNVDPYVAYVHE 343
                ...|:|             |:..:|.|: |...:.  |..|:|.|.|.|.:||.|...||
  Fly   523 ----NNDYRL-------------RKNGSLYCF-YDTKIRTFYSLLAPIKAEVLFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528 30/147 (20%)
P4Hc 347..515 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 30/145 (21%)
TPR repeat 452..491 CDD:276809 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462011
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.