DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PH4alphaSG1 and phy-3

DIOPT Version :9

Sequence 1:NP_733376.1 Gene:PH4alphaSG1 / 326112 FlyBaseID:FBgn0051014 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:263 Identity:57/263 - (21%)
Similarity:102/263 - (38%) Gaps:53/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 QVCRGELHQSPREQRNLRCWLYHQGVPYYRLSPFKIEQLNVDP----------------YVAYVH 342
            ::|..|...:..::.:..|..|     .|.:.|..:|.::..|                ::.::.
 Worm    55 ELCDDETKDTKWQKNDSICITY-----VYNMLPVDMEIISWAPTLVIYRNLMSPRQTASFLNFIE 114

  Fly   343 ----EVLWDSEIDTIME--HGKGNMERSKVGQSENSTTSEVRISRNTWLWYDANPWLSKIKQRLE 401
                |:...|:..|.:|  |.:.|  .|.:...:::.|.|:::                  |..:
 Worm   115 QRDLEIQKTSDFGTSIETTHRRAN--GSFIPPEDSNVTVEIKM------------------QAQK 159

  Fly   402 DVTGLSTESAEPLQLVNYGIGGQYEPHFDFVEDDGQSVFSW----KGNRLLTALFYLNDVALGGA 462
            .:.||:...||....::|..||.|..|:|:::...:..:.|    .|||:.|.:|.|.....||.
 Worm   160 RIPGLNLTVAEHFSALSYLPGGHYAVHYDYLDYRSKQDYDWWMNKTGNRIGTLIFVLKPAEKGGG 224

  Fly   463 TAFPFLRLAVPPVKGSLLIWYNLHSSTHKDFRTKHAGCPVLQGSKWICNEWFHVGAQEF--RRPC 525
            |.||.:...|....|....|:|..:...|:..:.|.|||:.:|.|.|...|.....|..  ..|.
 Worm   225 TVFPSIGSTVRANAGDAFFWFNAQADEEKEMLSNHGGCPIYEGRKVIATIWIRAYNQRILPMAPA 289

  Fly   526 GLS 528
            |.|
 Worm   290 GSS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PH4alphaSG1NP_733376.1 P4Ha_N 23..157 CDD:285528
P4Hc 347..515 CDD:214780 44/173 (25%)
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 45/194 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.