DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and AT1G20270

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_564109.1 Gene:AT1G20270 / 838615 AraportID:AT1G20270 Length:287 Species:Arabidopsis thaliana


Alignment Length:216 Identity:74/216 - (34%)
Similarity:107/216 - (49%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 TEQIGLDPYVVLYHEVLSAREISMLIGKAAQNM-KNTKIHKERAVPKKNRGRTAKGFWLKKESNE 382
            ||.:..:|...:||..||..|...||..|..:| |:|.:..|....|.:|.||:.|.:|::..::
plant    76 TEVLSWEPRAFVYHNFLSKEECEYLISLAKPHMVKSTVVDSETGKSKDSRVRTSSGTFLRRGRDK 140

  Fly   383 LTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHMDYF--DFASSNHTDTRSRYSIDLGDRI 445
            :.|.|.:||.|.|.......||.||::|..|..|..|.|||  :|.:.|.           |.|:
plant   141 IIKTIEKRIADYTFIPADHGEGLQVLHYEAGQKYEPHYDYFVDEFNTKNG-----------GQRM 194

  Fly   446 ATVLFYLTDVEQGGATVF-------------------GDVGYYVSPQAGTAIFWYNLDTDGNGDP 491
            ||:|.||:|||:||.|||                   |..|..|.|:.|.|:.::::..|...||
plant   195 ATMLMYLSDVEEGGETVFPAANMNFSSVPWYNELSECGKKGLSVKPRMGDALLFWSMRPDATLDP 259

  Fly   492 RTRHAACPVIVGSKWVMTEWI 512
            .:.|..||||.|:||..|:|:
plant   260 TSLHGGCPVIRGNKWSSTKWM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 68/199 (34%)
AT1G20270NP_564109.1 CASIMO1 <3..38 CDD:420385
PLN00052 79..286 CDD:177683 72/213 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.