DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and AT5G18900

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_197391.1 Gene:AT5G18900 / 832008 AraportID:AT5G18900 Length:298 Species:Arabidopsis thaliana


Alignment Length:245 Identity:70/245 - (28%)
Similarity:103/245 - (42%) Gaps:45/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 LESSTRL----HCFYNFTTTPFLRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNT 354
            |:|||.|    ..|.|          |.|.:|:...|...:|...|:..|...::..|..::|.:
plant    18 LQSSTSLISSSSVFVN----------PSKVKQVSSKPRAFVYEGFLTELECDHMVSLAKASLKRS 72

  Fly   355 KI-HKERAVPKKNRGRTAKGFWLKKESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFL 418
            .: ..:....|.:..||:.|.::.|..:.:...|..:|...|.....:.|..||:.|..|..|..
plant    73 AVADNDSGESKFSEVRTSSGTFISKGKDPIVSGIEDKISTWTFLPKENGEDIQVLRYEHGQKYDA 137

  Fly   419 HMDYFDFASSNHTDTRSRYSIDLGDRIATVLFYLTDVEQGGATVFGDV----------------- 466
            |.|||      |....   .:..|.|:||:|.||::|.:||.|||.|.                 
plant   138 HFDYF------HDKVN---IVRGGHRMATILMYLSNVTKGGETVFPDAEIPSRRVLSENKEDLSD 193

  Fly   467 ----GYYVSPQAGTAIFWYNLDTDGNGDPRTRHAACPVIVGSKWVMTEWI 512
                |..|.|:.|.|:.::||..|...||.:.|..||||.|.||..|:||
plant   194 CAKRGIAVKPRKGDALLFFNLHPDAIPDPLSLHGGCPVIEGEKWSATKWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 57/199 (29%)
AT5G18900NP_197391.1 PLN00052 33..298 CDD:177683 64/230 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.