DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and AT3G28490

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_189490.2 Gene:AT3G28490 / 822479 AraportID:AT3G28490 Length:288 Species:Arabidopsis thaliana


Alignment Length:223 Identity:69/223 - (30%)
Similarity:100/223 - (44%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 PLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKERAVPKKNRG-------RTAKG 373
            |.:..|:...|...||...||..|...|| |.|:.    |:.|...|...:.|       ||:.|
plant    29 PTRITQLSWTPRAFLYKGFLSDEECDHLI-KLAKG----KLEKSMVVADVDSGESEDSEVRTSSG 88

  Fly   374 FWLKKESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHMDYFDFASSNHTDTRSRYS 438
            .:|.|..:::...:..::...|.....:.|..|:::|..|..|..|.|||          ..:.:
plant    89 MFLTKRQDDIVANVEAKLAAWTFLPEENGEALQILHYENGQKYDPHFDYF----------YDKKA 143

  Fly   439 IDL-GDRIATVLFYLTDVEQGGATVF------------------GDVGYYVSPQAGTAIFWYNLD 484
            ::| |.||||||.||::|.:||.|||                  ...||.|.|:.|.|:.::||.
plant   144 LELGGHRIATVLMYLSNVTKGGETVFPNWKGKTPQLKDDSWSKCAKQGYAVKPRKGDALLFFNLH 208

  Fly   485 TDGNGDPRTRHAACPVIVGSKWVMTEWI 512
            .:|..||.:.|.:||||.|.||..|.||
plant   209 LNGTTDPNSLHGSCPVIEGEKWSATRWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 63/203 (31%)
AT3G28490NP_189490.2 PLN00052 28..288 CDD:177683 69/223 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.