DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and P4H2

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:251 Identity:74/251 - (29%)
Similarity:106/251 - (42%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 LESSTRLHCFYNFTTTPFLRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHK 358
            |:|||.|      .::|...:.|.|.:|:...|...:|...|:..|...||..|.:|::.:    
plant    19 LQSSTCL------ISSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRS---- 73

  Fly   359 ERAVPKKNRG-------RTAKGFWLKKESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHY 416
              ||...:.|       ||:.|.::.|..:.:...|..::...|.....:.|..||:.|..|..|
plant    74 --AVADNDNGESQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKY 136

  Fly   417 FLHMDYF----DFASSNHTDTRSRYSIDLGDRIATVLFYLTDVEQGGATVFGDV----------- 466
            ..|.|||    :.|...|             ||||||.||::|.:||.|||.|.           
plant   137 DAHFDYFHDKVNIARGGH-------------RIATVLLYLSNVTKGGETVFPDAQEFSRRSLSEN 188

  Fly   467 ----------GYYVSPQAGTAIFWYNLDTDGNGDPRTRHAACPVIVGSKWVMTEWI 512
                      |..|.|:.|.|:.::||..|...||.:.|..||||.|.||..|:||
plant   189 KDDLSDCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSLHGGCPVIEGEKWSATKWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 62/209 (30%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 62/209 (30%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.