DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and P4H2

DIOPT Version :10

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:251 Identity:74/251 - (29%)
Similarity:106/251 - (42%) Gaps:57/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 LESSTRLHCFYNFTTTPFLRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHK 358
            |:|||.|      .::|...:.|.|.:|:...|...:|...|:..|...||..|.:|::.:    
plant    19 LQSSTCL------ISSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKENLQRS---- 73

  Fly   359 ERAVPKKNRG-------RTAKGFWLKKESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHY 416
              ||...:.|       ||:.|.::.|..:.:...|..::...|.....:.|..||:.|..|..|
plant    74 --AVADNDNGESQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKY 136

  Fly   417 FLHMDYF----DFASSNHTDTRSRYSIDLGDRIATVLFYLTDVEQGGATVFGDV----------- 466
            ..|.|||    :.|...|             ||||||.||::|.:||.|||.|.           
plant   137 DAHFDYFHDKVNIARGGH-------------RIATVLLYLSNVTKGGETVFPDAQEFSRRSLSEN 188

  Fly   467 ----------GYYVSPQAGTAIFWYNLDTDGNGDPRTRHAACPVIVGSKWVMTEWI 512
                      |..|.|:.|.|:.::||..|...||.:.|..||||.|.||..|:||
plant   189 KDDLSDCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSLHGGCPVIEGEKWSATKWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..162 CDD:462433
NrfG <181..256 CDD:443378
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 62/209 (30%)
P4H2NP_566279.1 PLN00052 37..299 CDD:177683 67/227 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.