DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:221 Identity:67/221 - (30%)
Similarity:105/221 - (47%) Gaps:27/221 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 LRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMK-NTKIHKERAVPKKNRGRTAKGFW 375
            ||:..:|.|.:...|.:::.|:.||..|...|...|...:: :|.:..:.....|:..||:.|.:
plant    70 LRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDVRTSSGMF 134

  Fly   376 LK--KESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHMDYFDFASSNHTDTRSRYS 438
            |.  :.|..:.:.|.:||...:.....:.|..||:.|.....|..|.|||       .||   ::
plant   135 LTHVERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYF-------ADT---FN 189

  Fly   439 IDL-GDRIATVLFYLTDVEQGGATVF-----GDV--------GYYVSPQAGTAIFWYNLDTDGNG 489
            :.. |.|:||:|.||||..:||.|.|     ||.        |..|.|..|.|:.::::..||..
plant   190 LKRGGQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLDGQS 254

  Fly   490 DPRTRHAACPVIVGSKWVMTEWIREK 515
            |||:.|..|.|:.|.||..|:|:|:|
plant   255 DPRSIHGGCEVLSGEKWSATKWMRQK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 58/193 (30%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 63/211 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.