DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and P4H13

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_850038.1 Gene:P4H13 / 816841 AraportID:AT2G23096 Length:274 Species:Arabidopsis thaliana


Alignment Length:288 Identity:77/288 - (26%)
Similarity:115/288 - (39%) Gaps:68/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 ENKKRNVP---IANAFKLSCNGPLESSTRLHCFYN-------FTTTPFLRLAPLKTEQIGLD--- 325
            :.||...|   ||..|.|:..|        .||:|       |:..|..|.: :..|...||   
plant     6 KEKKLVFPYVFIACCFFLAIFG--------FCFFNLFSQGISFSEIPTTRRS-VNDETDSLDHGS 61

  Fly   326 -------------PYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKERAVPKKNRGRTAKGF-WL 376
                         |.|.......:.::...:|..|...:|.:.:    |:.|.....|.:.: .|
plant    62 SVSNIPFHGLSWNPRVFYLPNFATKQQCEAVIDMAKPKLKPSTL----ALRKGETAETTQNYRSL 122

  Fly   377 KKESNE----LTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHMDYFDFASSNHTDTRSRY 437
            .:.::|    :...|..:|...|.|.....|.|.::.|.:|..|..|.|.|..|         .|
plant   123 HQHTDEDESGVLAAIEEKIALATRFPKDYYESFNILRYQLGQKYDSHYDAFHSA---------EY 178

  Fly   438 SIDLGDRIATVLFYLTDVEQGGATVF---------------GDVGYYVSPQAGTAIFWYNLDTDG 487
            ...:..|:.|.|.:|:.||:||.|:|               ..||..|.|:.|.|||:|||..:|
plant   179 GPLISQRVVTFLLFLSSVEEGGETMFPFENGRNMNGRYDYEKCVGLKVKPRQGDAIFFYNLFPNG 243

  Fly   488 NGDPRTRHAACPVIVGSKWVMTEWIREK 515
            ..|..:.|.:||||.|.|||.|:|||::
plant   244 TIDQTSLHGSCPVIKGEKWVATKWIRDQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 56/196 (29%)
P4H13NP_850038.1 TatC <4..>40 CDD:294353 11/41 (27%)
P4Hc 85..269 CDD:214780 56/196 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.