DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and p4htmb

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htmb / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio


Alignment Length:387 Identity:93/387 - (24%)
Similarity:142/387 - (36%) Gaps:117/387 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 PRHLPIKEVDALRL-------LAEAQIKDQNYSEALPLLHNCLKLQPHD--ARVLRLWK------ 258
            ||::.:..::.:|:       |...::.:.......|||.........:  |.|:||.:      
Zfish   119 PRNMFLPRIEGIRVGHVQKVSLVSGKVHEMKTLSLKPLLFEIPDFLSEEECAVVVRLAQLKGLME 183

  Fly   259 ------KTTDFIENQPDQSPTENKKRNVPIANAFKLSCNGPLE----------------SSTRLH 301
                  :..:.::.|.:.||.|       |.|...|:.:|.|:                :|..|.
Zfish   184 SQVMVPEGQEELDQQLNLSPEE-------IFNFLDLNQDGQLQPHEILTHSRVRDGIWLTSENLK 241

  Fly   302 CFYNFTTTPFLRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKERAVPKKN 366
            ..|:          .||.:..|        :.:||..|...|...|.|     :...:|.|.:..
Zfish   242 EIYD----------GLKADLDG--------NGLLSLEEFGRLRSDAFQ-----RFLLQRGVERSQ 283

  Fly   367 RGRTAKGFWLKKES------NELTKRITRRIMDMTGFDLAD-SEGFQVINYGIGGHYFLHMD--- 421
            ..|.::..||.:..      .:|.||:|  ::......|.: ||..||:.|..||||..|.|   
Zfish   284 LVRNSRHTWLYQGQGAHQVLQDLRKRVT--LLTRLPSSLVELSEPLQVVRYEQGGHYHAHHDSGP 346

  Fly   422 YFDFASSNHT----DTRSRYSIDLGDRIATVLFYLTDVEQGGATVF---------------GDV- 466
            .:...:..||    :|.|.:....  |..||||||.:|::||.|.|               .|| 
Zfish   347 VYPETACTHTRLAANTTSPFQTSC--RYITVLFYLNNVQEGGETTFPVADNRTYEEASLIQNDVD 409

  Fly   467 -----------GYYVSPQAGTAIFWYNLDTDGNG-----DPRTRHAACPVIVGSKWVMTEWI 512
                       ...|.|..|||:||||..:||.|     |..:.|..|.|..|:|||...||
Zfish   410 LLDTRKHCDKGNLRVKPVKGTAVFWYNYLSDGRGWVGEQDEYSLHGGCVVTQGTKWVANNWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150 7/45 (16%)
TPR repeat 211..246 CDD:276809 5/41 (12%)
P4Hc 336..513 CDD:214780 66/223 (30%)
p4htmbXP_001340234.2 EF-hand_7 204..262 CDD:290234 14/82 (17%)
EFh 204..262 CDD:298682 14/82 (17%)
P4Hc 285..471 CDD:214780 57/189 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583459
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.