DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and Y43F8B.19

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001123044.2 Gene:Y43F8B.19 / 6418801 WormBaseID:WBGene00077688 Length:243 Species:Caenorhabditis elegans


Alignment Length:216 Identity:55/216 - (25%)
Similarity:96/216 - (44%) Gaps:17/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 LKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKERAVPKK-----NRGRTAKGFWL 376
            :|.|.:...|.:|:|.::.:.:::.    ...:.|::.|..::..|...     ::.|.|.|..:
 Worm    22 VKVEVVAWRPGLVIYRDLFTGKQVR----DHLELMEHLKFEEQLVVNDDGNDIVSKIRRANGTQV 82

  Fly   377 KKESNELTKRI---TRRIMDMTGFDLADSEGFQVINYGIGGHYFLHMDYFDFASSNHTDTRSRYS 438
            ..|.:...:.|   .:.::....|..|  |....::|..||||..|.||..:.|....|...|.:
 Worm    83 FHEDHPAARSIWDTAKNLLPNLNFKTA--EDILALSYNPGGHYAAHHDYLLYPSEKEWDEWMRVN 145

  Fly   439 IDLGDRIATVLFYLTDVEQGGATVFGDVGYYVSPQAGTAIFWYNLDTDGNGDPRTRHAACPVIVG 503
               |:|..|::......|.||||||..:|..|..:.|.|.||:|...:...:..:.||.||:..|
 Worm   146 ---GNRFGTLIMAFGAAESGGATVFPRLGAAVRTKPGDAFFWFNAMGNSEQEDLSEHAGCPIYKG 207

  Fly   504 SKWVMTEWIREKRQIFIRPCL 524
            .|.:.|.|:|.:.|..:...|
 Worm   208 QKQISTIWLRMRDQPILEQTL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 47/184 (26%)
Y43F8B.19NP_001123044.2 P4Hc 43..217 CDD:214780 47/182 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.