DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and P4HTM

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_808807.2 Gene:P4HTM / 54681 HGNCID:28858 Length:563 Species:Homo sapiens


Alignment Length:312 Identity:74/312 - (23%)
Similarity:104/312 - (33%) Gaps:119/312 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 VLSAREISMLIGKAAQNMKNTKIHKERAVPKKNRG---RTAKGFWL--KKESNELTKRITRRIMD 393
            |||.:|.|        ||.....||.....|....   |.:...||  .:.::.:.:.|.:|::.
Human   243 VLSLQEFS--------NMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLR 299

  Fly   394 MTGF--DLAD-SEGFQVINYGIGGHYFLHMD---YFDFASSNHTDTRSRYSIDL----------- 441
            :|..  ::.: ||..||:.||.||||..|:|   .:.....:||...:..|:..           
Human   300 LTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNW 364

  Fly   442 ----------------------------GDR------------------------IATVLFYLTD 454
                                        ||.                        ..||||||.:
Human   365 GLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYSYMTVLFYLNN 429

  Fly   455 VEQGGATVF---------------GDV------------GYYVSPQAGTAIFWYNLDTDGNG--- 489
            |..||.|||               .||            ...|.||.|||:||||...||.|   
Human   430 VTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQGWVG 494

  Fly   490 --DPRTRHAACPVIVGSKWVMTEWI-----REKRQIFIRPCLPKAKGTSTKS 534
              |..:.|..|.|..|:||:...||     |.::.:|.:.....|:...|.|
Human   495 DVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGTDS 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 67/287 (23%)
P4HTMNP_808807.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..111
EF-hand_7 192..252 CDD:290234 5/16 (31%)
EFh 194..252 CDD:238008 5/16 (31%)
P4Hc 246..519 CDD:214780 64/280 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149316
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.