DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and P4htm

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:236 Identity:70/236 - (29%)
Similarity:99/236 - (41%) Gaps:58/236 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   334 VLSAREISMLIGKAAQNMKNTKIHKERAVPKKNRG---RTAKGFWLK--KESNELTKRITRRIMD 393
            |||.:|.|        ||.....||.....|....   |.:...||.  :.::.:.:.|.:|::.
  Rat   244 VLSLQEFS--------NMDLRDFHKYMRSHKAESSELVRNSHHTWLHQGEGAHHVMRAIRQRVLR 300

  Fly   394 MTGF--DLAD-SEGFQVINYGIGGHYFLHMD---YFDFASSNHTDTRSRYSI--DLGDRIATVLF 450
            :|..  ::.: ||..||:.||.||||..|:|   .:.....:||...:..|:  :...|..||||
  Rat   301 LTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETVCSHTKLVANESVPFETSCRYMTVLF 365

  Fly   451 YLTDVEQGGATVF--GDVGYY-------------------------VSPQAGTAIFWYNLDTDGN 488
            ||.:|..||.|||  .|...|                         |.||.|||:||||...||.
  Rat   366 YLNNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQ 430

  Fly   489 G-----DPRTRHAACPVIVGSKWVMTEWI-----REKRQIF 519
            |     |..:.|..|.|..|:||:...||     |.::.:|
  Rat   431 GWVGEVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALF 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 66/226 (29%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 5/16 (31%)
P4Hc 247..459 CDD:214780 63/219 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343191
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.