DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31013 and LOC110438249

DIOPT Version :9

Sequence 1:NP_733394.3 Gene:CG31013 / 326111 FlyBaseID:FBgn0051013 Length:534 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:208 Identity:86/208 - (41%)
Similarity:121/208 - (58%) Gaps:14/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 EQIGLD-PYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKERAVPKKN---RGRTAKGFWLKKES 380
            |::..| |.::.||:.||..||..:  |.....|.::.....||..|.   ..|.::..||.::.
Zfish    26 EEVEWDQPMILRYHDFLSEGEIDTI--KTLARPKLSRAQVIDAVSGKRVSAASRVSQSAWLYEDE 88

  Fly   381 NELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHMDYFDFASSNHTDTRSRYSIDLGDRI 445
            :.:..::.:||.|:||.:|..:|..|:.||||||.|..|   :|...:|.:|.:.|     |.||
Zfish    89 DPVVTQVNQRIADVTGLELQTAESLQIANYGIGGQYEPH---YDSKLTNDSDFQLR-----GGRI 145

  Fly   446 ATVLFYLTDVEQGGATVFGDVGYYVSPQAGTAIFWYNLDTDGNGDPRTRHAACPVIVGSKWVMTE 510
            ||||.|::||:.||||||.|||..:.|:.|:|:.|:||..:||.|.||.||||||.||||||..:
Zfish   146 ATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLLRNGNEDIRTLHAACPVFVGSKWVANK 210

  Fly   511 WIREKRQIFIRPC 523
            |||...|.|.|.|
Zfish   211 WIRTYGQEFRRKC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31013NP_733394.3 P4Ha_N 31..160 CDD:285528
TPR_11 178..248 CDD:290150
TPR repeat 211..246 CDD:276809
P4Hc 336..513 CDD:214780 74/179 (41%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 81/199 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.