DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57e and Obp99b

DIOPT Version :9

Sequence 1:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:109 Identity:27/109 - (24%)
Similarity:40/109 - (36%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TSVFNPCVSQNELSEYEAHQVMENWPVPPIDRAYKCFLTCVLLDLGLIDERGNVQIDK--YMKSG 84
            |:....||.:...|| |..:..:.|..|. |....|:|.|:....|..|......:.|  ...:|
  Fly    34 TNYRTQCVEKVHASE-ELVEKYKKWQYPD-DAVTHCYLECIFQKFGFYDTEHGFDVHKIHIQLAG 96

  Fly    85 ----VVDWQWVAIELVTCRIEFSDERDLCELSYGIFNCFKDVKL 124
                |.:...|..::..|....|.|.|.|..:|....||.:..|
  Fly    97 PGVEVHESDEVHQKIAHCAETHSKEGDSCSKAYHAGMCFMNSNL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 25/100 (25%)
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 26/104 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.