powered by:
Protein Alignment Obp57e and Obp99d
DIOPT Version :9
Sequence 1: | NP_611488.1 |
Gene: | Obp57e / 326110 |
FlyBaseID: | FBgn0050145 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651712.1 |
Gene: | Obp99d / 43496 |
FlyBaseID: | FBgn0039684 |
Length: | 137 |
Species: | Drosophila melanogaster |
Alignment Length: | 91 |
Identity: | 20/91 - (21%) |
Similarity: | 30/91 - (32%) |
Gaps: | 39/91 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 WPVPPIDRAY----KC----------FLTCVLLDLGL-IDE------------RGNVQIDKYM-- 81
|.:|.....| || .|.|::..||| .|| .|:.|:::.|
Fly 28 WKLPTAQMVYEDLEKCRQESQEEDAATLRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLV 92
Fly 82 ----------KSGVVDWQWVAIELVT 97
.|.:.||.::|....|
Fly 93 VEHCNRMEQDTSHLDDWAFLAYRCAT 118
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.