DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57e and Obp99d

DIOPT Version :10

Sequence 1:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster


Alignment Length:91 Identity:20/91 - (21%)
Similarity:30/91 - (32%) Gaps:39/91 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WPVPPIDRAY----KC----------FLTCVLLDLGL-IDE------------RGNVQIDKYM-- 81
            |.:|.....|    ||          .|.|::..||| .||            .|:.|:::.|  
  Fly    28 WKLPTAQMVYEDLEKCRQESQEEDAATLRCLVKKLGLWTDESGYNARRIAKIFAGHNQMEELMLV 92

  Fly    82 ----------KSGVVDWQWVAIELVT 97
                      .|.:.||.::|....|
  Fly    93 VEHCNRMEQDTSHLDDWAFLAYRCAT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 20/91 (22%)
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:460193 16/77 (21%)

Return to query results.
Submit another query.