DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57e and Obp83cd

DIOPT Version :10

Sequence 1:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster


Alignment Length:95 Identity:24/95 - (25%)
Similarity:36/95 - (37%) Gaps:17/95 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VSQNELSEYEAHQVME-NWPVPPIDRAYKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDWQWVA 92
            |.|:|...::|..... |.|:|       ||..|.:..|.:.:|:..:...:.||      |.:.
  Fly   157 VHQDEWKSFDAFAYYPVNEPIP-------CFTRCFVDKLHIFEEKTRLWKLEAMK------QNLG 208

  Fly    93 IELVTCRIEFSDE---RDLCELSYGIFNCF 119
            |.....||.....   ||.|...|..|.|:
  Fly   209 IPAKGARIRTCHRHRGRDRCATYYKQFTCY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 24/95 (25%)
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783
PhBP 149..242 CDD:214783 24/95 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.