DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57e and Obp69a

DIOPT Version :9

Sequence 1:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster


Alignment Length:134 Identity:28/134 - (20%)
Similarity:55/134 - (41%) Gaps:31/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTLCLLLNFLCAN--VLANTSVFNP-------CVSQNELSEYEAHQVMENWPVPPIDRAYKCFLT 60
            |.|.:|.:.:.:|  |..|.::...       |::|...|.....:.::| .:.|.|...||||.
  Fly    10 LALLILYDLIPSNQGVEINPTIIKQVRKLRMRCLNQTGASVDVIDKSVKN-RILPTDPEIKCFLY 73

  Fly    61 CVLLDLGLIDERGNVQIDKYMK----------SGVVDWQWVAIELVTCRIEFSDERDLCELSYGI 115
            |:....||||.:..:.::..::          :|:|.         :|..:  ..:|.|:.:|..
  Fly    74 CMFDMFGLIDSQNIMHLEALLEVLPEEIHKTINGLVS---------SCGTQ--KGKDGCDTAYET 127

  Fly   116 FNCF 119
            ..|:
  Fly   128 VKCY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 22/102 (22%)
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.