DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57e and Obp57d

DIOPT Version :9

Sequence 1:NP_611488.1 Gene:Obp57e / 326110 FlyBaseID:FBgn0050145 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_725973.1 Gene:Obp57d / 246671 FlyBaseID:FBgn0043536 Length:136 Species:Drosophila melanogaster


Alignment Length:131 Identity:37/131 - (28%)
Similarity:69/131 - (52%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLDQLTLCLLLNFLCANV-------LANTSVFNPCVSQNELSEYEAHQVMENWP----VPPIDRA 54
            |.::::|.|:.:..|...       :|:::  :||.....:.|..|..::.:||    :..:.|:
  Fly     1 MPEKMSLRLVPHLACIIFILEIQFRIADSN--DPCPHNQGIDEDIAESILGDWPANVDLTSVKRS 63

  Fly    55 YKCFLTCVLLDLGLIDERGNVQIDKYMKSGVVDWQWVAIELVTCRIEFSDERDLCELSYGIFNCF 119
            :||::||:|....::...|.:.:|||..:||:|...||.::..||.||..|.|.|...:.||||.
  Fly    64 HKCYVTCILQYYNIVTASGEIFLDKYYDTGVIDELAVAPKINRCRYEFRMETDYCSRIFAIFNCL 128

  Fly   120 K 120
            :
  Fly   129 R 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57eNP_611488.1 PhBP 28..123 CDD:214783 31/97 (32%)
Obp57dNP_725973.1 PBP_GOBP <38..131 CDD:279703 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016906
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.