DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and TRAF4

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_011523806.1 Gene:TRAF4 / 9618 HGNCID:12034 Length:477 Species:Homo sapiens


Alignment Length:223 Identity:58/223 - (26%)
Similarity:97/223 - (43%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 NVKNIVCETEE-----RCDKLDRALHQTMQNISDLETQMAMQQRIAS-----VQNIR-------- 333
            |...::|..::     ||.||..|.|..    ..::..:||...:.|     :|.:|        
Human   251 NTALVLCPFKDSGCKHRCPKLAMARHVE----ESVKPHLAMMCALVSRQRQELQELRRELEELSV 311

  Fly   334 ---GHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNV 394
               |.|||:|..|.::|:|:|....: ..|..|....:||.|::..:|||.|:.:|.::...:.|
Human   312 GSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRV 376

  Fly   395 LSGEYDPLLAWPCRLQAEIIIRDQC-TNVADAEDYVKTIFVRKKSDDF----------IQSNQYF 448
            |.|.:|.||.||...:....:.||. ..:|..:...:|........:|          .:|:..|
Human   377 LPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGF 441

  Fly   449 HIP----HKVITSRNYLRNDSMFIEVRV 472
            ..|    |:.|..|||:|:|::||...|
Human   442 GYPKFISHQDIRKRNYVRDDAVFIRAAV 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587
MATH_TRAF_C 334..473 CDD:238168 45/155 (29%)
TRAF4XP_011523806.1 RING 18..55 CDD:238093
zf-TRAF 109..163 CDD:280357
zf-TRAF 217..276 CDD:280357 7/24 (29%)
MATH_TRAF4 315..470 CDD:239750 45/155 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.