DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and Traf1

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001258169.1 Gene:Traf1 / 687813 RGDID:1596290 Length:409 Species:Rattus norvegicus


Alignment Length:370 Identity:94/370 - (25%)
Similarity:158/370 - (42%) Gaps:82/370 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GTIRSVL-NEEIRQRLHLITDVGNIRKQNQVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQ 186
            |:.:||. :|...|..||...:|       |:::|           :............|:|||.
  Rat    92 GSPQSVQEHEATSQSSHLYLLLG-------VLKEW-----------KSSPGPNLGSAPMALEQNL 138

  Fly   187 LDVQYCCDITQSLKEQVESRLDEAQKLVNQLSADVTYH----QNQLNDNILKLEELIFENERLNR 247
            .::|                |.||.::...|..| .|.    ::|        |||..::  |.:
  Rat   139 SELQ----------------LQEAVEVTGDLEVD-CYRAPCCESQ--------EELALQH--LLK 176

  Fly   248 EKFF-QIEEFLQ-------QINEDIKTK---LGNSDYVTSKQATLDYEVKNVKNIVCETEERCDK 301
            ||.. |:||.|:       .:|::::..   |..|.:    |:.||.|  :|.|:    |:|..:
  Rat   177 EKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIH----QSQLDRE--HVLNL----EQRVVE 231

  Fly   302 LDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNK 365
            |.:.|.|..|.:..||..:    |:....:..|..:|:|.:.:|:..||....|: |.|..|...
  Rat   232 LQQTLAQKDQVLGKLEHSL----RLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTA 292

  Fly   366 AFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT--NVADA--E 426
            .:||.|.|.:||||.|:.|..::...:.::.||||.||.||.|.:...::.||..  :..||  .
  Rat   293 KYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRP 357

  Fly   427 DYVKTIFVRKKSDDFIQSNQYFHIPHKVITS--RNYLRNDSMFIE 469
            |.....|.|.:|:..:.|......|...:.|  ..|:::|:||::
  Rat   358 DLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587
MATH_TRAF_C 334..473 CDD:238168 44/143 (31%)
Traf1NP_001258169.1 TRAF_BIRC3_bd 180..237 CDD:406958 16/66 (24%)
MATH_TRAF1 260..406 CDD:239748 44/143 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10131
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.