DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and Rnf151

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_080481.1 Gene:Rnf151 / 67504 MGIID:1914754 Length:239 Species:Mus musculus


Alignment Length:187 Identity:39/187 - (20%)
Similarity:70/187 - (37%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KSSSRKDLTEQNQYQNQNENQNQPKSTTIVKYE---KSSCLFCNEWFDAQTFTEHLIHCGQVLEE 66
            |..:|:.:.|.|:.:.           ||.:.:   |::...|.:........||...|...|..
Mouse    59 KEVTRRKMVEVNKLRK-----------TIGRLQVKCKNAAAGCLDTHPLAHRKEHQDSCPFELMA 112

  Fly    67 CPN-GCQAFIPRIRMRSHLKECPRN-------------------QHNLSNQQRMSVSMDRLDRQS 111
            ||| ||...:.|..:..|.:.|.:|                   .||...:.|.:    .:.|..
Mouse   113 CPNEGCTVQVLRGVLDEHRQHCQQNGQQRCPLGCGSTLAALEGEHHNCYRELRDA----WVQRHE 173

  Fly   112 DQRLLVIEQDVGTIR------SVLNEEIRQRLHLITDVGNIRKQNQVVE-DWTRETE 161
            ..|.|::.. :|.:|      |::::::.|..:.:.|..|:....||.| :.|.|.|
Mouse   174 RNRTLLLGL-LGRVRRVHLTTSIIHQQLAQLSNFLEDDDNLLLNAQVQETEVTPEAE 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 11/34 (32%)
MATH_TRAF_C 334..473 CDD:238168
Rnf151NP_080481.1 RING 20..61 CDD:238093 1/1 (100%)
Sina 83..>134 CDD:302762 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.