DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and rnf41

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_998681.1 Gene:rnf41 / 406837 ZFINID:ZDB-GENE-040426-2920 Length:318 Species:Danio rerio


Alignment Length:312 Identity:56/312 - (17%)
Similarity:111/312 - (35%) Gaps:108/312 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FCN----EWFDAQTF---------TEHLIHCGQVLE--------ECPN---GCQAFIPRIRMRSH 83
            |||    :||..|..         ..||....:::.        .|.|   ||.|.:...:::||
Zfish    38 FCNACITQWFAQQQICPVDRTVVTLAHLRPVPRIMRNMLSKLQISCDNAGFGCTATLRLDQLQSH 102

  Fly    84 LKECPRN-QHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIR 147
            ||:|..| :..::.::...:.|.: |...:...      :..:|||:.::               
Zfish   103 LKDCEHNPKRPVTCEEGCGLEMPK-DEMPNHNC------IKHLRSVVQQQ--------------- 145

  Fly   148 KQNQVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSLKEQVESRLDEAQK 212
             |.::.     :.||...:.:.|:.|:           :.|:|    :.::....:.|       
Zfish   146 -QTKIA-----DLEKTAAEHKHQLAEQ-----------KRDIQ----LLKAYMRAIRS------- 182

  Fly   213 LVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKFFQIEEFLQQINEDIKTKLGNSDYVTSK 277
                           .|.|:..|||.|..||         |.|::..:.....|:.|.  .:::.
Zfish   183 ---------------ANPNLQNLEESIEYNE---------ILEWVNSLQPARVTRWGG--MISTP 221

  Fly   278 QATLDYEVKNVKNIV---CETEERCDKLDRALHQTM-QNISDLETQMAMQQR 325
            .|.|...:|  ::::   |......|.::.|..:.. |.::.|||:. |.:|
Zfish   222 DAVLQAVIK--RSLIDSGCPLSIVNDLIENAHERNWPQGLATLETRQ-MNRR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 11/44 (25%)
MATH_TRAF_C 334..473 CDD:238168
rnf41NP_998681.1 RING 18..55 CDD:238093 6/16 (38%)
USP8_interact 137..315 CDD:286082 35/206 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.