DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and elgi

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster


Alignment Length:173 Identity:39/173 - (22%)
Similarity:68/173 - (39%) Gaps:39/173 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VKYEKSSCLFC-NEWFDAQ---------TFTEHLIHCGQVL-----------EECPNGCQAFIPR 77
            |..|.:.|..| |||...|         ..|.:|....::|           :..|.||.|.:..
  Fly    32 VMCEHAFCRGCINEWLTRQPTCPVDRNSLTTANLRAVPRILRNLLSRLSITCDNAPYGCTAVLKL 96

  Fly    78 IRMRSHLKEC---PRNQHNLSNQQRMSVSMDRLDRQS---DQRLLVIEQ--DVGTIRSVLNEEIR 134
            ....|||.||   |:............:..|.|...:   :.|.|:::|  .:|.::|.|.:   
  Fly    97 DAYNSHLDECIHNPKRPFPCEKGCGFDIPKDELKDHNCVRELRTLIVKQTEKMGELKSELTD--- 158

  Fly   135 QRLHLITDVGNIRKQNQVVEDWTRE---TEKAMDDLRRQMEEE 174
            |:|    .:..::::.|:.:|:.|.   :..||..:..|||.:
  Fly   159 QQL----TINELKRELQLFKDFMRAMRVSNPAMRAIADQMERD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 12/47 (26%)
MATH_TRAF_C 334..473 CDD:238168
elgiNP_001261904.1 RING 17..55 CDD:238093 8/22 (36%)
Sina 83..>157 CDD:302762 17/73 (23%)
USP8_interact 137..315 CDD:286082 16/68 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.