DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and CG9014

DIOPT Version :10

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_609668.2 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster


Alignment Length:82 Identity:23/82 - (28%)
Similarity:32/82 - (39%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KSSCLF----CNEWFDAQTFTEHLIHC---GQVLEECPNGCQAFIPRIRMRSHLKECPRNQHNLS 95
            |..|.|    |.:....:.|..|:..|   .:|:.||..||...:|:..|..|  .|......|.
  Fly    80 KIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMSRH--NCVFELRELV 142

  Fly    96 NQQRMSVSMDRLDRQSD 112
            .:....|| |...:|||
  Fly   143 EKLAKEVS-DLKQKQSD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 SMC_prok_B <131..>336 CDD:274008
MATH_TRAF_C 334..473 CDD:238168
CG9014NP_609668.2 RING_Ubox 15..57 CDD:473075
USP8_interact 137..319 CDD:430333 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.