DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and rnf41l

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_002664951.1 Gene:rnf41l / 337495 ZFINID:ZDB-GENE-030131-9441 Length:292 Species:Danio rerio


Alignment Length:186 Identity:36/186 - (19%)
Similarity:72/186 - (38%) Gaps:40/186 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CLF----CNEWFDAQTFTEHLIHCGQVLEECPN-GCQAFIPRIRMRSHLKECPRN---------- 90
            |:|    |......::...|...|...|..|.| ||...:.|..:.:||..|..:          
Zfish    82 CVFRPQGCEVICALESIHRHEQQCDYALLNCTNTGCPVQVSRRSLEAHLCVCEYSSRVCASGCGY 146

  Fly    91 --------QHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEI-RQRLHLITDVGNI 146
                    |||..::.|..:.|.|.:         ::..|..:|..:...: .||.|::.....:
Zfish   147 TILNTDEAQHNCVSELRAELDMLRAE---------LDCKVEEVRHEMESRLDSQRRHMVQKESLL 202

  Fly   147 RKQNQVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSLKEQ 202
            |.:   |::...:..:.|.|:|..:..|..|:. .:|:.:|:.   .::.:.||::
Zfish   203 RSE---VDELKAQLSRVMSDVRVLLGAERARRQ-ELERAELEK---AELLELLKKE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 10/34 (29%)
MATH_TRAF_C 334..473 CDD:238168
rnf41lXP_002664951.1 zf-RING_2 18..53 CDD:290367
Sina 82..>130 CDD:302762 11/47 (23%)
DUF1640 150..>234 CDD:285090 18/96 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.