DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and Rnf151

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001100457.1 Gene:Rnf151 / 302977 RGDID:1309302 Length:238 Species:Rattus norvegicus


Alignment Length:152 Identity:41/152 - (26%)
Similarity:60/152 - (39%) Gaps:50/152 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KYEKSSCLF----C-NEWFDAQ----TFTEHLIHC---GQVLEECPNGCQAFIPRIRMRSHLKEC 87
            |..:.||.|    | ||...||    ...||..||   ||  :.||.||.|.:..:.        
  Rat   100 KGHQDSCPFELMACPNEGCTAQVLRGVLDEHRQHCQQNGQ--QRCPLGCGATLAALE-------- 154

  Fly    88 PRNQHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIRKQ--- 149
             ..|||...:.|.:    .:.|....|.|::.. :|.:|         |::..|::  ||:|   
  Rat   155 -GEQHNCYRELRDA----WVQRHERNRTLLLNL-LGRVR---------RVYRTTNL--IRRQLAQ 202

  Fly   150 -NQVVEDWT-------RETEKA 163
             :..:||.|       :|||.|
  Rat   203 LSNFLEDDTLLLNARVQETEVA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 11/36 (31%)
MATH_TRAF_C 334..473 CDD:238168
Rnf151NP_001100457.1 RING_Ubox 20..58 CDD:418438
Sina 83..>134 CDD:418524 11/33 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.