DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and Traf5

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_035763.2 Gene:Traf5 / 22033 MGIID:107548 Length:558 Species:Mus musculus


Alignment Length:534 Identity:118/534 - (22%)
Similarity:187/534 - (35%) Gaps:189/534 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLTKSSSRKDLTEQNQYQNQNENQNQPKSTTIVKYEKSSCLFCNEWFDAQTFTEHLIH-CGQVLE 65
            |..::..|||:.|.              .:...::.:..||:|..........:|..: |.....
Mouse   143 SCREAMLRKDVKEH--------------LSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPV 193

  Fly    66 ECPNGCQAFIPRIRMRSHLKECPRNQH----------------NLSNQQRMSVSMDRLDRQSDQR 114
            .|||.|...|||.|:..||..||..:.                ||...:|.::        .|..
Mouse   194 SCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAAL--------QDHM 250

  Fly   115 LLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIRKQNQVVEDWTRETEKAMDDLRRQMEEETNRKA 179
            |||:|:         |.::.||:                                          
Mouse   251 LLVLEK---------NYQLEQRI------------------------------------------ 264

  Fly   180 FAIEQNQLDVQYCCDITQSLKEQVESRLDEAQKLVNQLSADVTYHQNQLNDNILKLEELIFENER 244
                         .|:.||| ||.||::                  .||.:.:.|.|:       
Mouse   265 -------------SDLYQSL-EQKESKI------------------QQLAETVKKFEK------- 290

  Fly   245 LNREKFFQIEEFLQQINEDIKTKLGNSDYVTS---KQATLDYEVKNVKNIVCETEERCD--KLDR 304
                   ::::|.|....: .|.|.|...:||   |.|.|:.:|:.:..||.:...|.|  .|..
Mouse   291 -------ELKQFTQMFGRN-GTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVD 347

  Fly   305 ALHQTMQNISDLETQMAMQQRIASVQ----------NIR--------------------GHLIWR 339
            |:....|.|:.||   |..||:..::          ||.                    |.|||:
Mouse   348 AVDSVKQRITQLE---ASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWK 409

  Fly   340 IKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLL 403
            :.||..|..|:.:..|: :.|..|.....||.|....||||.|:.||.::.....|:.||:|.||
Mouse   410 VTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLL 474

  Fly   404 AWPCRLQAEIIIRDQC--------TNVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVI-TSRN 459
            .||.|.:..:::.||.        |..||..   .:.|.|...:..|.|.....:.|..: .|:|
Mouse   475 QWPFRQRVTLMLLDQSGKKNHIVETFKADPN---SSSFKRPDGEMNIASGCPRFVSHSTLENSKN 536

  Fly   460 -YLRNDSMFIEVRV 472
             |:::|::|::|.|
Mouse   537 TYIKDDTLFLKVAV 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 12/34 (35%)
MATH_TRAF_C 334..473 CDD:238168 47/150 (31%)
Traf5NP_035763.2 mRING-HC-C3HC3D_TRAF5 43..85 CDD:319556
zf-TRAF 128..183 CDD:280357 8/53 (15%)
zf-TRAF 185..241 CDD:424248 15/55 (27%)
Smc <237..>419 CDD:224117 56/290 (19%)
Interaction with EIF2AK2/PKR. /evidence=ECO:0000250 345..558 58/212 (27%)
MATH_TRAF5 404..551 CDD:239749 47/150 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10131
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.