DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and Traf1

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001313530.1 Gene:Traf1 / 22029 MGIID:101836 Length:409 Species:Mus musculus


Alignment Length:354 Identity:80/354 - (22%)
Similarity:138/354 - (38%) Gaps:102/354 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 VVEDWTRE-----------TEKAMDDLRRQ--------MEEETNRKAFAIEQNQLDVQYCCDITQ 197
            |:::|...           .|:.:.:|:.|        :|.:..|......|.:|.:|:.  :.:
Mouse   115 VLKEWKSSPGSNLGSAPMALERNLSELQLQAAVEATGDLEVDCYRAPCCESQEELALQHL--VKE 177

  Fly   198 SLKEQVESRLDEAQKLVNQLSADV---------TYHQNQLN-DNILKLEELIFENERLNREKFFQ 252
            .|..|:|.:|.....:|..|:.:|         :.||:||: ::||.||:.:.|           
Mouse   178 KLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVVE----------- 231

  Fly   253 IEEFLQQINEDIKTKLGNSDYVTSKQATLDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLE 317
                |||       .|...|.|..                        ||:.:|           
Mouse   232 ----LQQ-------TLAQKDQVLG------------------------KLEHSL----------- 250

  Fly   318 TQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTI-LHSAMFSNKAFGYALRLDIYLNGKG 381
                   |:....:..|..:|:|.:.:|:..||....|: |.|..|....:||.|.|.:||||.|
Mouse   251 -------RLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDG 308

  Fly   382 TWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT--NVADA--EDYVKTIFVRKKSDDFI 442
            :.|..::...:.::.||||.||.||.|.:...::.||..  :..||  .|.....|.|.:|:..:
Mouse   309 SGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNV 373

  Fly   443 QSNQYFHIPHKVITS--RNYLRNDSMFIE 469
            .|......|...:.|  ..|:::|:||::
Mouse   374 ASGCPLFFPLSKLQSPKHAYVKDDTMFLK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587
MATH_TRAF_C 334..473 CDD:238168 44/143 (31%)
Traf1NP_001313530.1 SMC_prok_B <126..257 CDD:274008 34/196 (17%)
TRAF_BIRC3_bd 180..237 CDD:374713 18/78 (23%)
MATH_TRAF1 260..406 CDD:239748 44/143 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10131
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.