DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and trf-2

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_491534.2 Gene:trf-2 / 172151 WormBaseID:WBGene00022454 Length:335 Species:Caenorhabditis elegans


Alignment Length:208 Identity:47/208 - (22%)
Similarity:89/208 - (42%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 DRALHQTM--QNISDLETQMAMQQRIASVQNIRGHLIW------RIKDYSK-------------- 345
            ||.||..:  |:::.:.|::.:||. |.|....|.|.:      ..:.|..              
 Worm   109 DRNLHLVLLCQSLNPIRTKINIQQS-AYVDKYVGMLQYMSIAESAFEKYGSQHTFRIPKIGLTVV 172

  Fly   346 KLEESKQYDTILHSAMFSNKAFGYALRLDI--YLNGKGTWKGRNMIACLNVLSGEYDPLLAWP-- 406
            |..::|.:.:| :|..|.:..:||.:....  |.:|....:..::..||  :.||:|.:|.||  
 Worm   173 KATKNKSHRSI-YSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCL--MKGEWDDILEWPFR 234

  Fly   407 CRLQAEIIIRDQCTNVADAEDYVKTIFVRKKSD--DFIQ-----SNQYF----HIPHKVITSRNY 460
            |.:...|:..|:      .|...|||:|.:..:  :|::     .|..|    .:|...:|  .:
 Worm   235 CDVTFSILSDDK------KELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVT--EF 291

  Fly   461 LRNDSMFIEVRVL 473
            ..:..:||:::||
 Worm   292 AADGDIFIQIKVL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587
MATH_TRAF_C 334..473 CDD:238168 35/173 (20%)
trf-2NP_491534.2 MATH_TRAF_C 158..304 CDD:238168 32/156 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.