DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and RNF151

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:XP_005255186.1 Gene:RNF151 / 146310 HGNCID:23235 Length:254 Species:Homo sapiens


Alignment Length:114 Identity:33/114 - (28%)
Similarity:49/114 - (42%) Gaps:19/114 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KYEKSSCLF---------CNEWFDAQTFTEHLIHCGQVLEE-CPNGCQAFI-PRIRMRSHLKECP 88
            |..:.||.|         |.......|..||..||.|..:: ||.||.|.: |..|.|.:   |.
Human   109 KGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGCGATLDPAERARHN---CY 170

  Fly    89 RNQHNL--SNQQR---MSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEE 132
            |..||.  ..|:|   :.:|:.|..|..||...|:.:::..:.:.|.|:
Human   171 RELHNAWSVRQERRRPLLLSLLRRVRWLDQATSVVRRELAELSNFLEED 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 13/35 (37%)
MATH_TRAF_C 334..473 CDD:238168
RNF151XP_005255186.1 RING 29..70 CDD:238093
Sina 92..>139 CDD:302762 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.