DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf-like and RNF41

DIOPT Version :9

Sequence 1:NP_727976.1 Gene:Traf-like / 32611 FlyBaseID:FBgn0030748 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001229755.1 Gene:RNF41 / 10193 HGNCID:18401 Length:317 Species:Homo sapiens


Alignment Length:316 Identity:63/316 - (19%)
Similarity:111/316 - (35%) Gaps:116/316 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FCN----EWFDAQ---------TFTEHLIHCGQVLEE--------CPN---GCQAFIPRIRMRSH 83
            |||    :||..|         ....||....:::..        |.|   ||.|.:....:.||
Human    38 FCNACITQWFSQQQTCPVDRSVVTVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSH 102

  Fly    84 LKECPRNQHNLSNQQRMSVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIRK 148
            |.:|   :||                  .:|.:..||..|.  .:..:|:... :.|..:.::.:
Human   103 LSDC---EHN------------------PKRPVTCEQGCGL--EMPKDELPNH-NCIKHLRSVVQ 143

  Fly   149 QNQVVEDWTR--ETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSLKEQVESRLDEAQ 211
            |.|     ||  |.||...:.:.|:.|:           :.|:|    :.::....:.|      
Human   144 QQQ-----TRIAELEKTSAEHKHQLAEQ-----------KRDIQ----LLKAYMRAIRS------ 182

  Fly   212 KLVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKFFQIEEFLQQINEDIKTKLGNSDYVTS 276
                            :|.|:..|||.|..||         |.|::..:.....|:.|.  .:::
Human   183 ----------------VNPNLQNLEETIEYNE---------ILEWVNSLQPARVTRWGG--MIST 220

  Fly   277 KQATLDYEVKNVKNIVCETEERC-----DKLDRALHQTM--QNISDLETQMAMQQR 325
            ..|.|...:|  :::|   |..|     ::|....|:..  |.::.|||:. |.:|
Human   221 PDAVLQAVIK--RSLV---ESGCPASIVNELIENAHERSWPQGLATLETRQ-MNRR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf-likeNP_727976.1 zf-TRAF_2 <54..88 CDD:292587 10/44 (23%)
MATH_TRAF_C 334..473 CDD:238168
RNF41NP_001229755.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:319548 6/18 (33%)
USP8_interact 137..315 CDD:401040 38/193 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.